PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0213s0310.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 456aa    MW: 50977.4 Da    PI: 5.8713
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0213s0310.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52391661128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             l+pGfrFhPtdeelv +yLk+kv++k++++ ++i+evdiyk ePwdL   +++k++++ewyfFs+ dkky +g r nrat +gyWka
  SapurV1A.0213s0310.1.p  39 LAPGFRFHPTDEELVIYYLKRKVSNKPFRF-NAISEVDIYKNEPWDLAdkSRLKSRDQEWYFFSPLDKKYGNGARMNRATGKGYWKA 124
                             579**************************9.89**************75348899999***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd+e+ + +++l  +kktLvf++grap g++t+Wvmheyrl
  SapurV1A.0213s0310.1.p 125 TGKDREIRR-QSQLLAMKKTLVFHSGRAPVGTRTNWVMHEYRL 166
                             ********9.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-6029191IPR003441NAC domain
PROSITE profilePS5100557.78439190IPR003441NAC domain
PfamPF023653.6E-2741166IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MGLETSSQEQ QLRLALTTPA PPVPAPEKTT PVSTKTTALA PGFRFHPTDE ELVIYYLKRK  60
VSNKPFRFNA ISEVDIYKNE PWDLADKSRL KSRDQEWYFF SPLDKKYGNG ARMNRATGKG  120
YWKATGKDRE IRRQSQLLAM KKTLVFHSGR APVGTRTNWV MHEYRLIDED LERTGAMQID  180
SYVLCRVFHK NNIGPPTGNR YAPFIEEEWD DCGAALIPGE DAAADEVVVT HDTGGEMHRT  240
EQDSHSINKS PLGITEVPGD SQNALPVCKT ESVEDCPPLC VLNTEAPLPL LQYKRRKHNN  300
DTGSIRSNAS ENSTRTSQDP CSSTTTTAAT TSAEMMMATT SATTTAISAL LEFSLMEPLE  360
PKENPRAPPP ALDAASLDSS MSPSCRKFIN DLQSEIHKIS VERETLKLEV MSAHTMINIL  420
QSRIDFLNKE NEDLKRIDFL NKENEDLKRS VPSEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-533819216167NAC domain-containing protein 19
4dul_A2e-533819216167NAC domain-containing protein 19
1ut7_B2e-533819216167NO APICAL MERISTEM PROTEIN
1ut7_A2e-533819216167NO APICAL MERISTEM PROTEIN
1ut4_B2e-533819216167NO APICAL MERISTEM PROTEIN
1ut4_A2e-533819216167NO APICAL MERISTEM PROTEIN
3swp_D2e-533819219170NAC domain-containing protein 19
3swp_C2e-533819219170NAC domain-containing protein 19
3swp_B2e-533819219170NAC domain-containing protein 19
3swp_A2e-533819219170NAC domain-containing protein 19
3swm_D2e-533819219170NAC domain-containing protein 19
3swm_C2e-533819219170NAC domain-containing protein 19
3swm_B2e-533819219170NAC domain-containing protein 19
3swm_A2e-533819219170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1453940.0EF145394.1 Populus trichocarpa clone WS01124_C05 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011024336.10.0PREDICTED: NAC transcription factor NAM-A1
TrEMBLA9PB020.0A9PB02_POPTR; No apical meristem family protein
STRINGPOPTR_0010s23630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF81893241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.11e-144NAC domain containing protein 50